Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL133C-A  from Saccharomyces cerevisiae S288C
>YJL133C-A|YJL133C-A YJL133C-A SGDID:S000028805, Chr X from 159847-159623, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies" ORGANISM: Saccharomyces cerevisiae S288C (74 aa)
MIAQSTRLAAAVSSSAASAGVSRIAASAMASTIFKRSPGNSFNSFKEYRENAKTYGPLSA
SLATRRHLAHAPKL