Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YJL127C-B  from Saccharomyces cerevisiae S288C
>YJL127C-B|YJL127C-B YJL127C-B SGDID:S000028522, Chr X from 181709-181551, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified based on homology to the filamentous fungus, Ashbya gossypii" ORGANISM: Saccharomyces cerevisiae S288C (52 aa)
MIFFFNQIRSIFTALHTPTQQIQLSRRAFFQFLGYLGSCVVISLAAQSKYVQ