Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL122W  from Saccharomyces cerevisiae S288C
>YJL122W|YJL122W ALB1 SGDID:S000003658, Chr X from 189716-190243, Genome Release 64-1-1, Verified ORF, "Shuttling pre-60S factor; involved in the biogenesis of ribosomal large subunit; interacts directly with Arx1p; responsible for Tif6p recycling defects in absence of Rei1p" ORGANISM: Saccharomyces cerevisiae S288C (175 aa)
MPSKNSINRPKLTSNLHHKVHSLNKKRAQRERAGLLKPARSSVNSKSGEIKSVALDLYFQ
NKKNESQNSTAVTLQNASSSPASITTRTLSKKRAKKIERNLKYATQRKLLVDASAKLEDE
MDIDLDGGKKVKENEKKSSLTLVKEALWSVIDDTASQGLIIENGQGTTLGGPFFP