Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL114W  from Saccharomyces cerevisiae S288C
>YJL114W|YJL114W YJL114W SGDID:S000003650, Chr X from 197915-198595, Genome Release 64-1-1, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag" ORGANISM: Saccharomyces cerevisiae S288C (226 aa)
MATPVRGETRNVIDDNISARIQSKVKTNDTVRQTPSSLRKVSIKDEQVRQYQRNLNRFKT
ILNGLKAEEEKLSEADDIQMLAEKLLKLGETIDKVENRIVDLVEKIQLLETNENNNILHE
HIDATGTYYLFDTLTSTNKRFYPKDCVFDYRTNNVENIPILLNNFKKFIKKYQFDDVFEN
DIIEIDPRENEILCKIIKEGLGESLDIMNTNTTDIFRIIDGLKKQI