Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL104W  from Saccharomyces cerevisiae S288C
>YJL104W|YJL104W PAM16 SGDID:S000003640, Chr X from 227327-227776, Genome Release 64-1-1, Verified ORF, "Constituent of the import motor (PAM complex) component of the Translocase of the Inner Mitochondrial membrane (TIM23 complex); forms a 1:1 subcomplex with Pam18p and inhibits its cochaperone activity; contains a J-like domain" ORGANISM: Saccharomyces cerevisiae S288C (149 aa)
MAHRAFIQVIITGTQVFGKAFAEAYRQAASQSVKQGATNASRRGTGKGEYGGITLDESCK
ILNIEESKGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLKWELAQREKNAK
AKAGDASTAKPPPNSTNSSGADNSASSNQ