Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YJL062W-A  from Saccharomyces cerevisiae S288C
>YJL062W-A|YJL062W-A COA3 SGDID:S000007611, Chr X from 316723-316980, Genome Release 64-1-1, Verified ORF, "Mitochondrial inner membrane protein that participates in regulation of COX1 translation, Cox1p stabilization, and cytochrome oxidase assembly" ORGANISM: Saccharomyces cerevisiae S288C (85 aa)
MVLNPSKYQDTRTWKMTPAMIRARKPFFKGNMLGLTLLLGVTGSVYYYTYHFLHKDNDFA
DVPIPPIDPQELEALKKEYEAKKKA