Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YJL052C-A  from Saccharomyces cerevisiae S288C
>YJL052C-A|YJL052C-A YJL052C-A SGDID:S000007610, Chr X from 338003-337884, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function, identified based on comparison to related yeast species" ORGANISM: Saccharomyces cerevisiae S288C (39 aa)
MHLRSRWWLALLYCKDPVSRSATTPKVETRASCLLSRAF