Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL038C  from Saccharomyces cerevisiae S288C
>YJL038C|YJL038C LOH1 SGDID:S000003575, Chr X from 375774-375115, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function with proposed roles in maintenance of genome integrity and also in spore wall assembly; induced during sporulation; repressed during vegetative growth by Sum1p and Hst1p; sequence similar to IRC1" ORGANISM: Saccharomyces cerevisiae S288C (219 aa)
MRFQLFIYFYFTIVVIAGTNTIQQFSDAGDRLITSLRNLDNNGTYETLTAEKVPIIEGQI
QNISAKYEQHTFILKGLEAVLNYKVKSLDNNERESLEIEYEKVEKALDAALNVSPFEYIK
KFKEVSRGKVVNALENLSREQNRITINGGREDEKEKEAREKKKRLDRIKRILTVSLLELG
LAQGVADLCAVAPFACLLGVTVGSIGFIFWLALIYNAIQ