Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL037W  from Saccharomyces cerevisiae S288C
>YJL037W|YJL037W IRC18 SGDID:S000003574, Chr X from 376662-377336, Genome Release 64-1-1, Verified ORF, "Putative protein of unknown function; expression induced in respiratory-deficient cells and in carbon-limited chemostat cultures; similar to adjacent ORF, YJL038C; null mutant displays increased levels of spontaneous Rad52p foci" ORGANISM: Saccharomyces cerevisiae S288C (224 aa)
MKVQMIERIFLIQLCLLTVVLASSRAVVEFESTGTKLVNSLRVLAAYSQSSVCVDEKISG
IERQIEEVKDMYGNHSFILKGLNGILNNKVNMLTREIQMETVGNNTFETETGKLTKGLNR
AVNISPFKYIKKFKTVSTKKFESLLNKYDLVAKKGGELTEEQKKKKEVLSRISRVVAATT
IEAGLAQGVVDLCITVTTSLCLVSASIGGVGFLIWLTIIYQALT