Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL030W  from Saccharomyces cerevisiae S288C
>YJL030W|YJL030W MAD2 SGDID:S000003567, Chr X from 387657-388247, Genome Release 64-1-1, Verified ORF, "Component of the spindle-assembly checkpoint complex; delays the onset of anaphase in cells with defects in mitotic spindle assembly; forms a complex with Mad1p; regulates APC/C activity during prometaphase and metaphase of meiosis I" ORGANISM: Saccharomyces cerevisiae S288C (196 aa)
MSQSISLKGSTRTVTEFFEYSINSILYQRGVYPAEDFVTVKKYDLTLLKTHDDELKDYIR
KILLQVHRWLLGGKCNQLVLCIVDKDEGEVVERWSFNVQHISGNSNGQDDVVDLNTTQSQ
IRALIRQITSSVTFLPELTKEGGYTFTVLAYTDADAKVPLEWADSNSKEIPDGEVVQFKT
FSTNDHKVGAQVSYKY