Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL011C  from Saccharomyces cerevisiae S288C
>YJL011C|YJL011C RPC17 SGDID:S000003548, Chr X from 414770-414285, Genome Release 64-1-1, reverse complement, Verified ORF, "RNA polymerase III subunit C17; physically interacts with C31, C11, and TFIIIB70; may be involved in the recruitment of pol III by the preinitiation complex" ORGANISM: Saccharomyces cerevisiae S288C (161 aa)
MKVLEERNAFLSDYEVLKFLTDLEKKHLWDQKSLAALKKSRSKGKQNRPYNHPELQGITR
NVVNYLSINKNFINQEDEGEERESSGAKDAEKSGISKMSDESFAELMTKLNSFKLFKAEK
LQIVNQLPANMVHLYSIVEECDARFDEKTIEEMLEIISGYA