Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YIR041W  from Saccharomyces cerevisiae S288C
>YIR041W|YIR041W PAU15 SGDID:S000001480, Chr IX from 433929-434303, Genome Release 64-1-1, Verified ORF, "Protein of unknown function, member of the seripauperin multigene family encoded mainly in subtelomeric regions" ORGANISM: Saccharomyces cerevisiae S288C (124 aa)
MVKLTSIAAGVAAIAAGVAAAPATTTLSPSDERVNLVELGVYVSDIRAHLAQYYLFQAAH
PSETYPVEIAEAVFNYGDFTTMLTGIPAEQVTRVITGVPWYSTRLRPAISSALSKDGIYT
AIPK