Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YIR024C  from Saccharomyces cerevisiae S288C
>YIR024C|YIR024C YIR024C SGDID:S000001463, Chr IX from 403491-402841, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies; interacts with Arh1p, a mitochondrial oxidoreductase; deletion mutant has a respiratory growth defect" ORGANISM: Saccharomyces cerevisiae S288C (216 aa)
MFMARQVLRNGLFLRSLAPIKITARTVASANAGIKRKSRFDKTMIKPLLLVMIFGSILNA
VIAEKRNIIDMERKYKLKLDKLKELIRRVHDNNGKVDFDADDELKLVNLRLGIVGKNATG
MKEDETDIVVPKEESLEEIWQSIIDEAKKEVIEKTPDAGVKNKEGIVTDLNVLKDLEKSK
KEDEKVYLSGDVHMMMNQPGDLNEIAKEHDKIPKFL