Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YIR015W  from Saccharomyces cerevisiae S288C
>YIR015W|YIR015W RPR2 SGDID:S000001454, Chr IX from 381948-382382, Genome Release 64-1-1, Verified ORF, "Subunit of nuclear RNase P; nuclear RNase P cleaves tRNA precursors to generate mature 5' ends and facilitates turnover of nuclear RNAs; not shared between RNase MRP and RNase P, in contrast to all other RNase P protein subunits" ORGANISM: Saccharomyces cerevisiae S288C (144 aa)
MGKKAHGGKMKPEIDENGTLLVPPPRTIANQDHFHRLNYLYQISAYQTRARQKARTDAHT
PLARNYIKSMDLISKKTKTSLLPTIKRTICKKCHRLLWTPKKLEITSDGALSVMCGCGTV
KRFNIGADPNYRTYSEREGNLLNS