>YIR009W|YIR009W MSL1 SGDID:S000001448, Chr IX from 374525-374860, Genome Release 64-1-1, Verified ORF, "U2B component of U2 snRNP, involved in splicing, binds the U2 snRNA stem-loop IV in vitro but requires association of Lea1p for in vivo binding; does not contain the conserved C-terminal RNA binding domain found in other family members" ORGANISM: Saccharomyces cerevisiae S288C (111 aa)
MVEPARKKQRIDRDTHHTVAEPVTEAKNTLYVSQLNEKINMQRLRVNLFLLFATFGEVLK
VSMNFKKQRGQAFITMRTIDQASLAQISLNGERFFGKPLKVEFSKSETKTL