Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YIR005W  from Saccharomyces cerevisiae S288C
>YIR005W|YIR005W IST3 SGDID:S000001444, Chr IX from 364889-365335, Genome Release 64-1-1, Verified ORF, "Component of the U2 snRNP, required for the first catalytic step of splicing and for spliceosomal assembly; interacts with Rds3p and is required for Mer1p-activated splicing" ORGANISM: Saccharomyces cerevisiae S288C (148 aa)
MNKIQQINDKELQSGILSPHQSWHNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDV
ILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSLQKYYE
AVKEELDRDIVSKNNAEKLILAKKDQPN