Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YIL176C  from Saccharomyces cerevisiae S288C
>YIL176C|YIL176C PAU14 SGDID:S000001438, Chr IX from 9155-8793, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Protein of unknown function, member of the seripauperin multigene family encoded mainly in subtelomeric regions; identical to Pau1p" ORGANISM: Saccharomyces cerevisiae S288C (120 aa)
MVKLTSIAAGVAAIAATASATTTLAQSDERVNLVELGVYVSDIRAHLAQYYMFQAAHPTE
TYPVEVAEAVFNYGDFTTMLTGISPDQVTRMITGVPWYSSRLKPAISSALSKDGIYTIAN