>YIL165C|YIL165C YIL165C SGDID:S000001427, Chr IX from 34077-33718, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; mutant exhibits mitophagy defects; in closely related species and other S. cerevisiae strain backgrounds YIL165C and adjacent ORF, YIL164C, likely constitute a single ORF encoding a nitrilase gene" ORGANISM: Saccharomyces cerevisiae S288C (119 aa)
MKNIAYEGRLFLISAVQFMPDATAMGFGEIIDQATGKRKLPGWPSADDNCINGGSVIIDP
YGEIIAGPLLGQEGLLTAEINTDLIAEARFDLDPVGHYARGDVFQLTVNERSHDVKFTK