Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YIL164C  from Saccharomyces cerevisiae S288C
>YIL164C|YIL164C NIT1 SGDID:S000001426, Chr IX from 34686-34087, Genome Release 64-1-1, reverse complement, Verified ORF, "Nitrilase, member of the nitrilase branch of the nitrilase superfamily; in closely related species and other S. cerevisiae strain backgrounds YIL164C and adjacent ORF, YIL165C, likely constitute a single ORF encoding a nitrilase gene" ORGANISM: Saccharomyces cerevisiae S288C (199 aa)
MAKHIVAALQIGSCPGSTKDTLKKILSYEKEIKESGAKLVVIPEATLGGYPKGSNFGVYL
GYRLQEGREEYAKYLAEAIEIGNGEKYPEISQLCALSKATDASLCVGCIERDGTTLYCTM
VYIDPKDGYVGKHRKLMPTAGERLIWGQGDGSTLPVVDTAAGKIGGAICWENMMPLLRYA
MYKKGVEIWCAPTVDARPI