Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YIL157C  from Saccharomyces cerevisiae S288C
>YIL157C|YIL157C COA1 SGDID:S000001419, Chr IX from 47542-46949, Genome Release 64-1-1, reverse complement, Verified ORF, "Mitochondrial inner membrane protein required for assembly of the cytochrome c oxidase complex (complex IV); interacts with complex IV assembly factor Shy1p during the early stages of assembly" ORGANISM: Saccharomyces cerevisiae S288C (197 aa)
MMLRLVTKGLPKVTPSAAKAVLVRGSLLHSFSTSARFNNSVAEDEAKIVLKDKNRPLRID
RELPDPTTERRKRIAGFLLFSVAIGSALSLIFNYEKTESPIISNTLYYIRRSPATKNILG
ESIEFDGIIPWVYGELNSVKGRINITFYIKGDKNVTGTVRLVADRNTHDEEFLIHEWSVT
AAGQKIDLLAENTKTPI