Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YIL138C  from Saccharomyces cerevisiae S288C
>YIL138C|YIL138C TPM2 SGDID:S000001400, Chr IX from 89715-89230, Genome Release 64-1-1, reverse complement, Verified ORF, "Minor isoform of tropomyosin, binds to and stabilizes actin cables and filaments, which direct polarized cell growth and the distribution of several organelles; appears to have distinct and also overlapping functions with Tpm1p" ORGANISM: Saccharomyces cerevisiae S288C (161 aa)
MEKIKEKLNSLKLESESWQEKYEELREQLKELEQSNTEKENEIKSLSAKNEQLDSEVEKL
ESQLSDTKQLAEDSNNLRSNNENYTKKNQDLEQQLEDSEAKLKEAMDKLKEADLNSEQMG
RRIVALEEERDEWEKKCEEFQSKYEEAQKELDEIANSLENL