Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YIL127C  from Saccharomyces cerevisiae S288C
>YIL127C|YIL127C RRT14 SGDID:S000001389, Chr IX from 117644-117024, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified in a screen for mutants with decreased levels of rDNA transcription; green fluorescent protein (GFP)-fusion protein localizes to the nucleolus; predicted to be involved in ribosome biogenesis" ORGANISM: Saccharomyces cerevisiae S288C (206 aa)
MSSSLSQTSKYQATSVVNGLLSNLLPGVPKIRANNGKTSVNNGSKAQLIDRNLKKRVQLQ
NRDVHKIKKKCKLVKKKKVKKHKLDKEQLEQLAKHQVLKKHQHEGTLTDHERKYLNKLIK
RNSQNLRSWDLEEEVRDELEDIQQSILKDTVSTANTDRSKRRRFKRKQFKEDIKESDFVK
DHRYPGLTPGLAPVGLSDEEDSSEED