Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YIL111W  from Saccharomyces cerevisiae S288C
>YIL111W|YIL111W COX5B SGDID:S000001373, Chr IX from 155222-155222,155311-155765, Genome Release 64-1-1, Verified ORF, "Subunit Vb of cytochrome c oxidase, which is the terminal member of the mitochondrial inner membrane electron transport chain; predominantly expressed during anaerobic growth while its isoform Va (Cox5Ap) is expressed during aerobic growth" ORGANISM: Saccharomyces cerevisiae S288C (151 aa)
MLRTSLTKGARLTGTRFVQTKALSKATLTDLPERWENMPNLEQKEIADNLTERQKLPWKT
LNNEEIKAAWYISYGEWGPRRPVHGKGDVAFITKGVFLGLGISFGLFGLVRLLANPETPK
TMNREWQLKSDEYLKSKNANPWGGYSQVQSK