Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YIL102C-A  from Saccharomyces cerevisiae S288C
>YIL102C-A|YIL102C-A YIL102C-A SGDID:S000113587, Chr IX from 173592-173365, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function, identified based on comparisons of the genome sequences of six Saccharomyces species" ORGANISM: Saccharomyces cerevisiae S288C (75 aa)
MNRFVIICLLFTYYVIWSLLPIFEIENSNPVVSLLFPISSNVAIFLPIFLLLIGFTLTGS
VLGVLLIRSDKKKKV