Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YIL098C  from Saccharomyces cerevisiae S288C
>YIL098C|YIL098C FMC1 SGDID:S000001360, Chr IX from 180239-179772, Genome Release 64-1-1, reverse complement, Verified ORF, "Mitochondrial matrix protein, required for assembly or stability at high temperature of the F1 sector of mitochondrial F1F0 ATP synthase; null mutant temperature sensitive growth on glycerol is suppressed by multicopy expression of Odc1p" ORGANISM: Saccharomyces cerevisiae S288C (155 aa)
MDRPRTLRTYRGLIRAILKYERPSKIVNWGNLRKAMITKLEYAKKQNQRDSHENINRQLE
KWKKLDPVSDRSLNLFIADSKSLRSILQNDIKWEKKVAQGQNVDEIFEHALDIIKFLDNQ
REYEELVDRYNPGNKLTQDEKVKRTANVVGLDVPT