Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YIL087C  from Saccharomyces cerevisiae S288C
>YIL087C|YIL087C AIM19 SGDID:S000001349, Chr IX from 200119-199646, Genome Release 64-1-1, reverse complement, Verified ORF, "Putative protein of unknown function; the authentic, non-tagged protein is detected in purified mitochondria in high-throughput studies; null mutant displays reduced respiratory growth" ORGANISM: Saccharomyces cerevisiae S288C (157 aa)
MSAKPATDDAKDELLSPFRRLYALTRTPYPALANAALLASTPVLSPSFKVPPTQSPALSI
PMSRVFSKSSTARIGITTKTALFFSTMQAIGAYMIYDNDLENGAGFIATWSALYLIVGGK
KSFSALRYGRTWPLVLSSVSLANAVLYGQRFLATGFQ