Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YIL069C  from Saccharomyces cerevisiae S288C
>YIL069C|YIL069C RPS24B SGDID:S000001331, Chr IX from 231957-231553,232369-232367, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps24Ap and has similarity to rat S24 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (135 aa)
MSDAVTIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEVYKAEKDAVSVFGF
RTQFGGGKSVGFGLVYNSVAEAKKFEPTYRLVRYGLAEKVEKASRQQRKQKKNRDKKIFG
TGKRLAKKVARRNAD