Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YIL065C  from Saccharomyces cerevisiae S288C
>YIL065C|YIL065C FIS1 SGDID:S000001327, Chr IX from 241775-241308, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein involved in mitochondrial membrane fission and peroxisome abundance; required for localization of Dnm1p and Mdv1p during mitochondrial division; mediates ethanol-induced apoptosis and ethanol-induced mitochondrial fragmentation" ORGANISM: Saccharomyces cerevisiae S288C (155 aa)
MTKVDFWPTLKDAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERL
GVKILTDIYKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMV
EDKIQKETLKGVVVAGGVLAGAVAVASFFLRNKRR