Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YIL062C  from Saccharomyces cerevisiae S288C
>YIL062C|YIL062C ARC15 SGDID:S000001324, Chr IX from 244462-243998, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of the ARP2/3 complex, which is required for the motility and integrity of cortical actin patches; has mRNA binding activity" ORGANISM: Saccharomyces cerevisiae S288C (154 aa)
MEADWRRIDIDAFDPESGRLTAADLVPPYETTVTLQELQPRMNQLRSLATSGDSLGAVQL
LTTDPPYSADAPTKEQYFKSVLEALTQVRQADIGNVIKNLSDSQRDVLVKYLYKGMSVPQ
GQKQGGVLLAWLERITQVSGVTPIVHYISDRRTV