Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YIL060W  from Saccharomyces cerevisiae S288C
>YIL060W|YIL060W YIL060W SGDID:S000001322, Chr IX from 246392-246826, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; mutant accumulates less glycogen than does wild type; null mutation results in a decrease in plasma membrane electron transport; YIL060W is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (144 aa)
MMIIIFIELCRIADSLLWIPKSSRRTSSTFYIPNIIALLKMESQQLSQNSPTLHIHTCGS
KIGTLFLRFTKVAIGTSLIVGAGVAMEVSVPLPPQPLYSRSEVPSVELCGIVAICRSPPS
VYPTCRPISLSKKIVSGLVRTNSS