Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YIL052C  from Saccharomyces cerevisiae S288C
>YIL052C|YIL052C RPL34B SGDID:S000001314, Chr IX from 256554-256226,257063-257027, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl34Ap and has similarity to rat L34 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (121 aa)
MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR
QYATVSKTHKTVSRAYGGSRCANCVKERIVRAFLIEEQKIVKKVVKEQTEAAKKSEKKSK
K