Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YIL051C  from Saccharomyces cerevisiae S288C
>YIL051C|YIL051C MMF1 SGDID:S000001313, Chr IX from 258280-257843, Genome Release 64-1-1, reverse complement, Verified ORF, "Mitochondrial protein required for transamination of isoleucine but not of valine or leucine; may regulate specificity of branched-chain transaminases Bat1p and Bat2p; interacts genetically with mitochondrial ribosomal protein genes" ORGANISM: Saccharomyces cerevisiae S288C (145 aa)
MFLRNSVLRTAPVLRRGITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKP
VQGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPA
RSCVGVASLPLNVDLEMEVIAVEKN