Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YIL046W-A  from Saccharomyces cerevisiae S288C
>YIL046W-A|YIL046W-A YIL046W-A SGDID:S000028836, Chr IX from 268309-268473, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; identified by expression profiling and mass spectrometry" ORGANISM: Saccharomyces cerevisiae S288C (54 aa)
MMCVCIPKKKLMDWRVYYIYSYVVCLYMCGSDCACICVLACVVQCVCFNVEMRL