Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YIL027C  from Saccharomyces cerevisiae S288C
>YIL027C|YIL027C KRE27 SGDID:S000001289, Chr IX from 304104-303679, Genome Release 64-1-1, reverse complement, Verified ORF, "Member of a transmembrane complex required for efficient folding of proteins in the ER; null mutant displays induction of the unfolded protein response, and also shows K1 killer toxin resistance" ORGANISM: Saccharomyces cerevisiae S288C (141 aa)
MSFVSKLLYTVSALVLFHSGFSSYEFHHLLKLNSLNNAQGAISKLPKDIMYETYAGLILF
VLAVFTSFEKLQYLPIESNDGKIISQGNYLKEIALNKATNVDNLIGSNPNGEIIFTPSFV
DVHMKRKICREWASNTVKKEK