>YIL008W|YIL008W URM1 SGDID:S000001270, Chr IX from 342536-342835, Genome Release 64-1-1, Verified ORF, "Ubiquitin-like protein involved in thiolation of cytoplasmic tRNAs; receives sulfur from the E1-like enzyme Uba4p and transfers it to tRNA; also functions as a protein tag with roles in nutrient sensing and oxidative stress response" ORGANISM: Saccharomyces cerevisiae S288C (99 aa)
MVNVKVEFLGGLDAIFGKQRVHKIKMDKEDPVTVGDLIDHIVSTMINNPNDVSIFIEDDS
IRPGIITLINDTDWELEGEKDYILEDGDIISFTSTLHGG