Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YIL004C  from Saccharomyces cerevisiae S288C
>YIL004C|YIL004C BET1 SGDID:S000001266, Chr IX from 348363-347946,348505-348495, Genome Release 64-1-1, reverse complement, Verified ORF, "Type II membrane protein required for vesicular transport between the endoplasmic reticulum and Golgi complex; v-SNARE with similarity to synaptobrevins" ORGANISM: Saccharomyces cerevisiae S288C (142 aa)
MSSRFAGGNAYQRDTGRTQLFGPADGSNSLDDNVSSALGSTDKLDYSQSTLASLESQSEE
QMGAMGQRIKALKSLSLKMGDEIRGSNQTIDQLGDTFHNTSVKLKRTFGNMMEMARRSGI
SIKTWLIIFFMVGVLFFWVWIT