Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YHR214C-E  from Saccharomyces cerevisiae S288C
>YHR214C-E|YHR214C-E YHR214C-E SGDID:S000028654, Chr VIII from 551499-551200, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (99 aa)
MYKITTIYLWLKSYLSFFIGLDNLDFLTLIRFFQCRLQNKLGLQDILDFFCNLCGHSMVR
TCNMVEAAQKQNRITFGSIYVKLHPLVKLCTGIVWAPRV