Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YHR213W-B  from Saccharomyces cerevisiae S288C
>YHR213W-B|YHR213W-B YHR213W-B SGDID:S000028652, Chr VIII from 540800-541099, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (99 aa)
MLIDFCCSYIAGTHGRERAPSFTGTFVSHVSAENNCRPRRSEITQPCASGTEKKHFAATE
KQCTNSLEGSRKDFLSLPLGHSYLFLFCFWRMICSEPKL