Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YHR213W-A  from Saccharomyces cerevisiae S288C
>YHR213W-A|YHR213W-A YHR213W-A SGDID:S000028651, Chr VIII from 540549-540782, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (77 aa)
MLAKTGDVVVQKVPVIRLSVFLHFFFVFPFCLLHRLYMGMKQVQEFIMEPKGSVFVVRAT
LRVSLENAGKIFFNETE