Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR193C  from Saccharomyces cerevisiae S288C
>YHR193C|YHR193C EGD2 SGDID:S000001236, Chr VIII from 488236-487712, Genome Release 64-1-1, reverse complement, Verified ORF, "Alpha subunit of the heteromeric nascent polypeptide-associated complex (NAC) involved in protein sorting and translocation, associated with cytoplasmic ribosomes" ORGANISM: Saccharomyces cerevisiae S288C (174 aa)
MSAIPENANVTVLNKNEKKARELIGKLGLKQIPGIIRVTFRKKDNQIYAIEKPEVFRSAG
GNYVVFGEAKVDNFTQKLAAAQQQAQASGIMPSNEDVATKSPEDIQADMQAAAEGSVNAA
AEEDDEEGEVDAGDLNKDDIELVVQQTNVSKNQAIKALKAHNGDLVNAIMSLSK