Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR191C  from Saccharomyces cerevisiae S288C
>YHR191C|YHR191C CTF8 SGDID:S000001234, Chr VIII from 486631-486230, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of a complex with Ctf18p that shares some subunits with Replication Factor C and is required for sister chromatid cohesion" ORGANISM: Saccharomyces cerevisiae S288C (133 aa)
MPSVDIDASQWQKLTQSREKQTTVITPLGMMMLEIQGELELPKDFASLARRDSPNEGRFS
EQDGETLIRFGSLQIDGERATLFVGKKQRLLGKVTKLDVPMGIMHFNSKDNKVELVDVMK
YKVIFKDRPLPIM