Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR185C  from Saccharomyces cerevisiae S288C
>YHR185C|YHR185C PFS1 SGDID:S000001228, Chr VIII from 475340-474627, Genome Release 64-1-1, reverse complement, Verified ORF, "Sporulation protein required for prospore membrane formation at selected spindle poles, ensures functionality of all four spindle pole bodies during meiosis II; not required for meiotic recombination or meiotic chromosome segregation" ORGANISM: Saccharomyces cerevisiae S288C (237 aa)
MNQGYTQLSAPELKETKTSKLNKMNNFRSSPIAEIINKIPPDCGKIQNTTFPEFNPALRR
RQHEQWPAYEKPIRVTDSMSPQLSSINCLPNLYPHGTLPLPNPYLSYLNHIEKVNCQDVK
FSNWSVLHNSNNGFEIPTYFSPRTTQNMPCSEKVESWLERLPIFVGFDGYLFTNCFDYEY
MLDWEETEFTFEKTSCMETDYSKALTDTDIIYIQEKKIEALIRNQYLKEYEFSQKDF