Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR181W  from Saccharomyces cerevisiae S288C
>YHR181W|YHR181W SVP26 SGDID:S000001224, Chr VIII from 467228-467914, Genome Release 64-1-1, Verified ORF, "Integral membrane protein of the early Golgi apparatus and endoplasmic reticulum, involved in COP II vesicle transport; may also function to promote retention of proteins in the early Golgi compartment" ORGANISM: Saccharomyces cerevisiae S288C (228 aa)
MLLELISYAGTVSGFLFLTLSIASGLYYISELVEEHTEPTRRFLTRAIYGIILILILLLL
LDGFPFKLTLFSIACYIVYYQNLKSFPFISLTSPTFLLSCVCVVLNHYFWFKYFNDTEVP
PQFKFDPNYIPRRRASFAEVASFFGICVWFIPFALFVSLSAGDYVLPTTSEQHMAKKNDD
ITTNNQPKFRKRAVGLARVVINSVRKYIYSLARVFGYEIEPDFDRLAV