Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YHR175W-A  from Saccharomyces cerevisiae S288C
>YHR175W-A|YHR175W-A YHR175W-A SGDID:S000028553, Chr VIII from 453558-453707, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; identified by fungal homology and RT-PCR" ORGANISM: Saccharomyces cerevisiae S288C (49 aa)
MINYVNITCIIFSTRTLLVFDTSLYIPPFMLSFIGYSLSNQNSPLFLYH