Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR162W  from Saccharomyces cerevisiae S288C
>YHR162W|YHR162W YHR162W SGDID:S000001205, Chr VIII from 423072-423461, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the mitochondrion" ORGANISM: Saccharomyces cerevisiae S288C (129 aa)
MSTSSVRFAFRRFWQSETGPKTVHFWAPTLKWGLVFAGFSDMKRPVEKISGAQNLSLLST
ALIWTRWSFVIKPRNILLASVNSFLCLTAGYQLGRIANYRIRNGDSISQLCSYILSGADE
SKKEITTGR