Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR152W  from Saccharomyces cerevisiae S288C
>YHR152W|YHR152W SPO12 SGDID:S000001195, Chr VIII from 401434-401955, Genome Release 64-1-1, Verified ORF, "Nucleolar protein of unknown function, positive regulator of mitotic exit; involved in regulating release of Cdc14p from the nucleolus in early anaphase, may play similar role in meiosis" ORGANISM: Saccharomyces cerevisiae S288C (173 aa)
MSNKASDQSARTASILKTDITRENTITRSSSSNNDNYHHHNNINNYNESAKTGEDANKEN
IPNLEEEIAAFRIFRKKSTSNLKSSHTTSNLVKKTMFKRDLLKQDPKRKLQLQQRFASPT
DRLVSPCSLKLNEHKVKMFGKKKKVNPMKLNFKGNLAADSEDVEIDEDEEYFY