>YHR141C|YHR141C RPL42B SGDID:S000001183, Chr VIII from 382306-381990,382751-382748, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl42Ap and has similarity to rat L44; required for propagation of the killer toxin-encoding M1 double-stranded RNA satellite of the L-A double-stranded RNA virus" ORGANISM: Saccharomyces cerevisiae S288C (106 aa)
MVNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFGGQTKPVFHK
KAKTTKKVVLRLECVKCKTRAQLTLKRCKHFELGGEKKQKGQALQF