Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR138C  from Saccharomyces cerevisiae S288C
>YHR138C|YHR138C YHR138C SGDID:S000001180, Chr VIII from 377699-377355, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; has similarity to Pbi2p; double null mutant lacking Pbi2p and Yhr138p exhibits highly fragmented vacuoles" ORGANISM: Saccharomyces cerevisiae S288C (114 aa)
MKASYLVLIFISIFSMAQASSLSSYIVTFPKTDNMATDQNSIIEDVKKYVVDIGGKITHE
YSLIKGFTVDLPDSDQILDGLKERLSYIESEYGAKCNLEKDSEVHALNRDHLVA