Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR136C  from Saccharomyces cerevisiae S288C
>YHR136C|YHR136C SPL2 SGDID:S000001178, Chr VIII from 375100-374654, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein with similarity to cyclin-dependent kinase inhibitors; downregulates low-affinity phosphate transport during phosphate limitation; overproduction suppresses a plc1 null mutation; GFP-fusion protein localizes to the cytoplasm" ORGANISM: Saccharomyces cerevisiae S288C (148 aa)
MGTYTPLIYNIYNVHIWVFTESQGQIGQMSPRGKMETAVSQGQHKQLKDGHQHKGRKLSE
EIASLLRLKECRRLNPASYYTPRRTSQSQSLSGSTFKEYNEYINEKDSSRAQRQNAAAVL
SKLAHDFWENDCVIDEDIFEDSSDEEQS