Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR132W-A  from Saccharomyces cerevisiae S288C
>YHR132W-A|YHR132W-A IGO2 SGDID:S000007496, Chr VIII from 370054-370449, Genome Release 64-1-1, Verified ORF, "Protein required for initiation of G0 program; prevents degradation of nutrient-regulated mRNAs via the 5'-3' mRNA decay pathway; phosphorylated by Rim15p; GFP protein localizes to the cytoplasm and nucleus; similar to Igo1p" ORGANISM: Saccharomyces cerevisiae S288C (131 aa)
MSEDLSPTSSRVDLSNPHGFTKEGVDLSKLSPQELKLYKMYGKLPSKKDLLRHKMQDRQY
FDSGDYALKKAGVIKSDDVIVNNSSNNLPVTNPSGLRESIIRRRMSSSSGGDSISRQGSI
SSGPPPRSPNK